"
Team:UTK-Knoxville/HemAT
From 2013.igem.org
(Difference between revisions)
(Created page with "<html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en" dir="ltr"><head> <title>Team:UK-Knoxville - 2013.igem.org</title> <link rel="stylesheet" type="text/css" me...") |
|||
| (2 intermediate revisions not shown) | |||
| Line 46: | Line 46: | ||
wgRestrictionEdit=[], | wgRestrictionEdit=[], | ||
wgRestrictionMove=[]; | wgRestrictionMove=[]; | ||
| - | </script> | + | |
| + | function MM_preloadImages() { //v3.0 | ||
| + | var d=document; if(d.images){ if(!d.MM_p) d.MM_p=new Array(); | ||
| + | var i,j=d.MM_p.length,a=MM_preloadImages.arguments; for(i=0; i<a.length; i++) | ||
| + | if (a[i].indexOf("#")!=0){ d.MM_p[j]=new Image; d.MM_p[j++].src=a[i];}} | ||
| + | } | ||
| + | </script> | ||
<script type="text/javascript" src="/wiki/skins/common/wikibits.js?270"><!-- wikibits js --></script> | <script type="text/javascript" src="/wiki/skins/common/wikibits.js?270"><!-- wikibits js --></script> | ||
<!-- Head Scripts --> | <!-- Head Scripts --> | ||
<script src="/wiki/skins/common/ajax.js?270"></script> | <script src="/wiki/skins/common/ajax.js?270"></script> | ||
| - | <script type="text/javascript" src="/wiki/index.php?title=-&action=raw&gen=js&useskin=igem"><!-- site js --></script> | + | <script type="text/javascript" src="/wiki/index.php?title=-&action=raw&gen=js&useskin=igem"><!-- site js --></script> |
| + | <style type="text/css"> | ||
| + | <!-- | ||
| + | .mediawiki.ltr.ns-0.ns-subject.page-Team_UTK-Knoxville p { | ||
| + | font-family: Arial, Helvetica, sans-serif; | ||
| + | } | ||
| + | .mediawiki.ltr.ns-0.ns-subject.page-Team_UTK-Knoxville #navi ul li { | ||
| + | font-family: Arial, Helvetica, sans-serif; | ||
| + | } | ||
| + | .mediawiki.ltr.ns-0.ns-subject.page-Team_UTK-Knoxville #article-title-1 a { | ||
| + | font-family: Arial, Helvetica, sans-serif; | ||
| + | } | ||
| + | --> | ||
| + | </style> | ||
</head> | </head> | ||
<body class="mediawiki ltr ns-0 ns-subject page-Team_UTK-Knoxville"> | <body class="mediawiki ltr ns-0 ns-subject page-Team_UTK-Knoxville"> | ||
| - | + | <!-- | |
| - | + | ||
<div id="jump-to-nav">Jump to: <a href="#column-one">navigation</a>, <a href="#searchInput">search</a></div>--> | <div id="jump-to-nav">Jump to: <a href="#column-one">navigation</a>, <a href="#searchInput">search</a></div>--> | ||
<!-- start content --> | <!-- start content --> | ||
| Line 416: | Line 434: | ||
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Overall Project</span></span></a></li> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Overall Project</span></span></a></li> | ||
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/methods"><span><span>Material & Methods</span></span></a> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/methods"><span><span>Material & Methods</span></span></a> | ||
| - | </li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | </li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/partsorigin"><span><span>Parts Origin</span></span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/construct"><span><span>Construct</span></span></a></li> |
| - | + | ||
| - | + | ||
</ul> | </ul> | ||
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
| - | + | </li> | |
<li> | <li> | ||
<a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon" style="color: white">Parts<!--[if gt IE 6]><!--></a><!--<![endif]--> | <a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon" style="color: white">Parts<!--[if gt IE 6]><!--></a><!--<![endif]--> | ||
| Line 431: | Line 447: | ||
<ul class="SideMenu" id="MB8-DDM8-SM7"> | <ul class="SideMenu" id="MB8-DDM8-SM7"> | ||
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/Aer"><span>Aer</span></a></li> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/Aer"><span>Aer</span></a></li> | ||
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>HemAT</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>RcoM</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>NarX</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>TodS</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>LasR</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>(EnvZ)</span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span>(NtrC)</span></a></li> |
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/primers"><span>Primers</span></a></li> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/primers"><span>Primers</span></a></li> | ||
</ul> | </ul> | ||
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Characterization</span></span></a></li> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Characterization</span></span></a></li> | ||
| - | + | </ul> | |
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
</li> | </li> | ||
| Line 449: | Line 465: | ||
<ul class="DropDownMenu" id="MB1-DDM3"> | <ul class="DropDownMenu" id="MB1-DDM3"> | ||
<li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Overview</span></span></a></li> | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Overview</span></span></a></li> | ||
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span> | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Background</span></span></a></li> |
| - | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span> | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Application</span></span></a></li> |
</ul> | </ul> | ||
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
| Line 457: | Line 473: | ||
<a href="https://2013.igem.org/Team:UTK-Knoxville/notebook" style="color: white">Notebook<!--[if gt IE 6]><!--></a><!--<![endif]--> | <a href="https://2013.igem.org/Team:UTK-Knoxville/notebook" style="color: white">Notebook<!--[if gt IE 6]><!--></a><!--<![endif]--> | ||
<!--[if lt IE 7]><table border="0" cellpadding="0" cellspacing="0"><tr><td><![endif]--> | <!--[if lt IE 7]><table border="0" cellpadding="0" cellspacing="0"><tr><td><![endif]--> | ||
| - | + | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | |
| - | + | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | |
| - | + | <ul class="DropDownMenu" id="MB1-DDM5"> | |
| - | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/notebook"><span><span>Daily Entries</span></span></a> | |
| - | + | </li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/methods"><span><span>Material & Methods</span></span></a> | |
| - | + | </li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Team Meetings</span></span></a> | |
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
</li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Seminar on DETAILS</span></span></a> | </li><li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Seminar on DETAILS</span></span></a> | ||
| - | + | </li></ul> | |
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
| - | + | </li> | |
<li style="width: 160px"> | <li style="width: 160px"> | ||
<a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon" style="color: white">oUTreach<!--[if gt IE 6]><!--></a><!--<![endif]--> | <a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon" style="color: white">oUTreach<!--[if gt IE 6]><!--></a><!--<![endif]--> | ||
<!--[if lt IE 7]><table border="0" cellpadding="0" cellspacing="0"><tr><td><![endif]--> | <!--[if lt IE 7]><table border="0" cellpadding="0" cellspacing="0"><tr><td><![endif]--> | ||
| - | + | <ul class="DropDownMenu" id="MB1-DDM4"> | |
| - | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/EastmanHITES"><span><span>Eastman HITES</span></span></a></li> | |
| - | + | <li><a href="https://2013.igem.org/Team:UTK-Knoxville/comingsoon"><span><span>Coming Soon</span></span></a></li> | |
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | </ul> | |
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
</li> | </li> | ||
| Line 514: | Line 503: | ||
</ul> | </ul> | ||
<!--[if lte IE 6]></td></tr></table></a><![endif]--> | <!--[if lte IE 6]></td></tr></table></a><![endif]--> | ||
| - | + | </li> | |
<li> | <li> | ||
<a href="https://2013.igem.org/Team:UTK-Knoxville/sponsors" style="color: white">Sponsors</a> | <a href="https://2013.igem.org/Team:UTK-Knoxville/sponsors" style="color: white">Sponsors</a> | ||
| Line 526: | Line 515: | ||
<map name="pBR322"> | <map name="pBR322"> | ||
<area shape="poly" coords="87,301" href="#"> | <area shape="poly" coords="87,301" href="#"> | ||
| - | <area shape="poly" coords="96,230,104,208,119,176,143,142,171,115,208,87,237,72,273,60,279,77,246,86,221,99,193,117,169,138,151,159,130,189,111,236" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="96,230,104,208,119,176,143,142,171,115,208,87,237,72,273,60,279,77,246,86,221,99,193,117,169,138,151,159,130,189,111,236" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#KanRDETAILS" alt="KanR"> |
| - | <area shape="poly" coords="342,49,339,69,372,73,376,54" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="342,49,339,69,372,73,376,54" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#T7promoterDETAILS" alt="T7"> |
| - | <area shape="poly" coords="552,385,567,393,581,346,584,309,579,247,550,172,504,117,420,66,380,56,378,72,432,91,494,132,549,210,568,298" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="552,385,567,393,581,346,584,309,579,247,550,172,504,117,420,66,380,56,378,72,432,91,494,132,549,210,568,298" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#NtrCDETAILS" alt="OmpR"> |
| - | <area shape="poly" coords="547,397,561,405,559,408,556,416,549,429,539,445,527,461,512,478,494,494,468,513,449,523,442,507,468,493,493,472,509,456,524,437,534,421,541,409" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="547,397,561,405,559,408,556,416,549,429,539,445,527,461,512,478,494,494,468,513,449,523,442,507,468,493,493,472,509,456,524,437,534,421,541,409" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#HemATDETAILS" alt="Aer"> |
| - | <area shape="poly" coords="235,511,266,525,302,532,332,535,359,533,378,530,402,524,421,517,429,513,437,529,428,533,416,538,401,543,372,548,335,551,299,549,259,539,227,528" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="235,511,266,525,302,532,332,535,359,533,378,530,402,524,421,517,429,513,437,529,428,533,416,538,401,543,372,548,335,551,299,549,259,539,227,528" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#NtrBDETAILS" alt="EnvZ"> |
| - | <area shape="poly" coords="158,480,148,469,134,452,123,435,108,409,97,384,91,355,87,328,84,305,100,306,103,336,108,357,120,395,138,428,152,446,164,459,171,468" href="https://2013.igem.org/Team:UTK-Knoxville/ | + | <area shape="poly" coords="158,480,148,469,134,452,123,435,108,409,97,384,91,355,87,328,84,305,100,306,103,336,108,357,120,395,138,428,152,446,164,459,171,468" href="https://2013.igem.org/Team:UTK-Knoxville/HemAT#pBR322DETAILS" alt="pBR322"> |
</map> | </map> | ||
</p> | </p> | ||
<p> </p> | <p> </p> | ||
<h3><span class="mw-headline" id="HemATDETAILS">HemAT</span></h3> | <h3><span class="mw-headline" id="HemATDETAILS">HemAT</span></h3> | ||
| + | <p><img src="https://static.igem.org/mediawiki/2013/thumb/f/fd/HemAT_sensing_domain.png/647px-HemAT_sensing_domain.png" alt="HemAT" width="647" height="599"></p> | ||
<p>Oxygen gas, sensor FixL or HemAT (also need HemC). <a href="http://scop.berkeley.edu/sunid=111118">list of Direct Oxygen sensors </a>. <strong>FixL,</strong> was fused with <a href="http://www.sciencedirect.com/science/article/pii/S1570963902005551">5 different kinases</a> : | <p>Oxygen gas, sensor FixL or HemAT (also need HemC). <a href="http://scop.berkeley.edu/sunid=111118">list of Direct Oxygen sensors </a>. <strong>FixL,</strong> was fused with <a href="http://www.sciencedirect.com/science/article/pii/S1570963902005551">5 different kinases</a> : | ||
“it was likely that the autophosphorylation activity of the histidine kinase domain could not be regulated by the O2 association/dissociation in the sensor domain in the chimeric proteins” Intracellular & redox sensor. <strong>O2 sensor, would be interesting. & may also be able to sense CO in the absence of oxygen </strong>It seems like FixL is an O2 sensor. </p> | “it was likely that the autophosphorylation activity of the histidine kinase domain could not be regulated by the O2 association/dissociation in the sensor domain in the chimeric proteins” Intracellular & redox sensor. <strong>O2 sensor, would be interesting. & may also be able to sense CO in the absence of oxygen </strong>It seems like FixL is an O2 sensor. </p> | ||
<p><a href="http://www.sciencedirect.com/science/article/pii/S0969212603001692">Sensing domain is from 1-186</a>, its cytoplasmic, so it might not work on EnvZ. It also does not HAMP domain so we do not think it would work on a <a href="http://aktuell.ruhr-uni-bochum.de/pm2012/pm00213.html.en">transmembrane kinase domain.</a></p> | <p><a href="http://www.sciencedirect.com/science/article/pii/S0969212603001692">Sensing domain is from 1-186</a>, its cytoplasmic, so it might not work on EnvZ. It also does not HAMP domain so we do not think it would work on a <a href="http://aktuell.ruhr-uni-bochum.de/pm2012/pm00213.html.en">transmembrane kinase domain.</a></p> | ||
<p><a href="http://www.sciencedirect.com/science/article/pii/S1570963902005551">Chimeric sensory kinases</a> containing O2 sensor domain of FixL and histidine kinase domain from thermophile.</p> | <p><a href="http://www.sciencedirect.com/science/article/pii/S1570963902005551">Chimeric sensory kinases</a> containing O2 sensor domain of FixL and histidine kinase domain from thermophile.</p> | ||
| - | <p>Oxygen‐Sensing Histidine‐Protein Kinases:<a href="http://www.sciencedirect.com/science/article/pii/S0076687907370109"> Assays of Ligand Binding and Turnover of | + | <p>Oxygen‐Sensing Histidine‐Protein Kinases:<a href="http://www.sciencedirect.com/science/article/pii/S0076687907370109"> Assays of Ligand Binding and Turnover of Response-Regulator Substrates</a>.</p> |
<p>Heme-based oxygen sensor protein FixL:<a href="http://www.sciencedirect.com/science/article/pii/S0531513102002364"> its structure and function</a>.</p> | <p>Heme-based oxygen sensor protein FixL:<a href="http://www.sciencedirect.com/science/article/pii/S0531513102002364"> its structure and function</a>.</p> | ||
<p><a href="http://www.uniprot.org/uniprot/P76129#section_seq">Direct oxygen</a><a href="http://www.ncbi.nlm.nih.gov/pmc/articles/PMC1305375/"> sensor protein</a>.</p> | <p><a href="http://www.uniprot.org/uniprot/P76129#section_seq">Direct oxygen</a><a href="http://www.ncbi.nlm.nih.gov/pmc/articles/PMC1305375/"> sensor protein</a>.</p> | ||
| Line 573: | Line 563: | ||
<p> </p> | <p> </p> | ||
<p><s>This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. </s></p> | <p><s>This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. </s></p> | ||
| + | <h4>Resources:</h4> | ||
| + | <h4 id="article-title-1" itemprop="headline"><a href="http://www.pnas.org/content/98/16/9353.full">Globin-coupled sensors: A class of heme-containing sensors in Archaea and Bacteria</a></h4> | ||
| + | <p><a href="http://www.google.com/patents/US7129329">Heme proteins hemAT-Hs and hemAT-Bs and their use in medicine and microsensors</a></p> | ||
| + | <h4 id="article-title-2" itemprop="headline"><a href="http://www.jbc.org/content/277/16/13528.full">Resonance Raman and Ligand Binding Studies of the Oxygen-sensing Signal Transducer Protein HemAT from <em>Bacillus subtilis</em></a><em></em></h4> | ||
| + | <p itemprop="headline"><a href="http://www.hawaii.edu/microbiology/Alam/research/index.html">Globin-Coupled Sensors and Protoglobins</a></p> | ||
| + | <p itemprop="headline"> </p> | ||
<p> </p> | <p> </p> | ||
<p><br> | <p><br> | ||
Latest revision as of 11:36, 5 August 2013
HemAT
HemAT
Oxygen gas, sensor FixL or HemAT (also need HemC). list of Direct Oxygen sensors . FixL, was fused with 5 different kinases : “it was likely that the autophosphorylation activity of the histidine kinase domain could not be regulated by the O2 association/dissociation in the sensor domain in the chimeric proteins” Intracellular & redox sensor. O2 sensor, would be interesting. & may also be able to sense CO in the absence of oxygen It seems like FixL is an O2 sensor.
Sensing domain is from 1-186, its cytoplasmic, so it might not work on EnvZ. It also does not HAMP domain so we do not think it would work on a transmembrane kinase domain.
Chimeric sensory kinases containing O2 sensor domain of FixL and histidine kinase domain from thermophile.
Oxygen‐Sensing Histidine‐Protein Kinases: Assays of Ligand Binding and Turnover of Response-Regulator Substrates.
Heme-based oxygen sensor protein FixL: its structure and function.
Amino Acid Sequence:
MLFKKDRKQETAYFSDSNGQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSL
MDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKA
IKATTKILNLEQQLVLE
KanR
KanR provides kanamycin resistance to colonies with successful transformations.
pBR322
The pBR322 ori is a low copy origin of replication derived from
NtrB
Details for NtrB coming soon.Details for NtrB coming soon.Details for NtrB coming soon.
NtrC
Details for NtrC coming soon.Details for NtrC coming soon.Details for NtrC coming soon.
T7 Promoter
The T7 promoter is constitutively expressed by the phage T7 RNA polymerase. The polymerase is orthogonal to the wildtype E. coli promoters.
This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.
Gel samples
This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.
Flow sample
This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go. This is where the deatils of Aer will go.
Resources:
Globin-coupled sensors: A class of heme-containing sensors in Archaea and Bacteria
Heme proteins hemAT-Hs and hemAT-Bs and their use in medicine and microsensors
Resonance Raman and Ligand Binding Studies of the Oxygen-sensing Signal Transducer Protein HemAT from Bacillus subtilis
Globin-Coupled Sensors and Protoglobins
[back]
