Team:TU-Munich/Results/Software
From 2013.igem.org
ChristopherW (Talk | contribs) (→Export of the Computed Parameters) |
ChristopherW (Talk | contribs) (→Export of the Computed Parameters) |
||
Line 43: | Line 43: | ||
<br> | <br> | ||
<html> | <html> | ||
- | <table border="1" cellspacing="0"><tr><td colspan="20"><strong | + | <table border="1" cellspacing="0"><tr><td colspan="20"><strong !important>Automatically determined parameters using the <a href="https://2013.igem.org/Team:TU-Munich/Results/Software">BioBrick-AutoAnnotator</a></strong></td></tr><tr><td colspan="20"><strong>Nucleotide sequence:</strong> (underlined part of entry was translated, italic parts were added)<br>GTACACA<u>ATGCGTCGT...TTCGAAAAA</u>TAA</tr><tr><td colspan="20"><strong>Amino acid sequence:</strong><br><code !important>MRRSANYQPSIWDHDFLQSLNSNYTDEAYKRRAEELRGKVKIAIKDVIEPLDQLDLIDNLQRLGLAHRFETEIRNILNNIYNNNKDYNWRKENLYATSLE<br>FRLLRQHGYPVSQEVFNGFKDDQGGFICDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLKEVMISKNMEEDVFVAEQAKRALELPLHWKVPMLEARW<br>FIHIYERREDKNHLLLELAKMEFNTLQAIYQEELKEISGWWKDTGLGEKLSFARNRLVASFLWSMGIAFEPQFAYCRRVLTISIALITVIDDIYDVYGTL<br>DELEIFTDAVERWDINYALKHLPGYMKMCFLALYNFVNEFAYYVLKQQDFDLLLSIKNAWLGLIQAYLVEAKWYHSKYTPKLEEYLENGLVSITGPLIIT<br>ISYLSGTNPIIKKELEFLESNPDIVHWSSKIFRLQDDLGTSSDEIQRGDVPKSIQCYMHETGASEEVARQHIKDMMRQMWKKVNAYTADKDSPLTGTTTE<br>FLLNLVRMSHFMYLHGDGHGVQNQETIDVGFTLLFQPIPLEDKHMAFTASPGTKGTGAWSHPQFEK</code><br><br></span></tr><tr><td colspan="10">BioBrick: <partinfo>BBa_K801060</partinfo></td><td colspan="10">Used open reading frame from position 8 to 1705 (excluding stop-codon; if appropriate prefix/suffix were added).</td></tr><tr><td colspan="2">A (Ala)</td><td colspan="2">33 (5.83%)</td><td colspan="2">R (Arg)</td><td colspan="2">25 (4.42%)</td><td colspan="2">N (Asn)</td><td colspan="2">27 (4.77%)</td><td colspan="2">D (Asp)</td><td colspan="2">34 (6.01%)</td><td colspan="2">C (Cys)</td><td colspan="2">4 (0.71%)</td></tr><tr><td colspan="2">Q (Gln)</td><td colspan="2">24 (4.24%)</td><td colspan="2">E (Glu)</td><td colspan="2">48 (8.48%)</td><td colspan="2">G (Gly)</td><td colspan="2">29 (5.12%)</td><td colspan="2">H (His)</td><td colspan="2">18 (3.18%)</td><td colspan="2">I (Ile)</td><td colspan="2">39 (6.89%)</td></tr><tr><td colspan="2">L (Leu)</td><td colspan="2">64 (11.31%)</td><td colspan="2">K (Lys)</td><td colspan="2">36 (6.36%)</td><td colspan="2">M (Met)</td><td colspan="2">16 (2.83%)</td><td colspan="2">F (Phe)</td><td colspan="2">28 (4.95%)</td><td colspan="2">P (Pro)</td><td colspan="2">17 (3.00%)</td></tr><tr><td colspan="2">S (Ser)</td><td colspan="2">33 (5.83%)</td><td colspan="2">T (Thr)</td><td colspan="2">26 (4.59%)</td><td colspan="2">W (Trp)</td><td colspan="2">14 (2.47%)</td><td colspan="2">Y (Tyr)</td><td colspan="2">27 (4.77%)</td><td colspan="2">V (Val)</td><td colspan="2">24 (4.24%)</td></tr><tr><td colspan="2"><strong>Amino acid counting:</strong></td><td colspan="4">Total number of amino acids (aa):</td><td colspan="2">566</td><td colspan="4">Number of positively charged aa (Arg + Lys):</td><td colspan="2">61</td><td colspan="4">Number of negatively charged aa (Asp + Glu):</td><td colspan="2">82</td></tr><tr><td colspan="2"><strong>Biochemical parameters:</strong></td><td colspan="4">Molecular weight [Da]:</td><td colspan="2">66105.33</td><td colspan="4">Theoretical pI:</td><td colspan="2">5.38</td><td colspan="4">Extinction coefficient: [M^-1 cm^-1]</td><td colspan="2">117480 (all Cys as cystine), 117230 (no Cys as cystine)</td></tr><tr><td colspan="2"><strong>Estimated half-life:</strong></td><td colspan="4"><i>Mammals:</i></td><td colspan="2">30 hour</td><td colspan="4"><i>Yeast:</i></td><td colspan="2">>20 hour</td><td colspan="4"><i>E. coli</i>:</td><td colspan="2">>10 hour</td></tr><tr><td colspan="2"><strong>Codon usage:</strong> (CAI)</td><td colspan="4"><i>Mammals:</i></td><td colspan="2">0.68</td><td colspan="4"><i>Yeast:</i></td><td colspan="2">0.69</td><td colspan="4"><i>E. coli</i>:</td><td colspan="2">0.71</td></tr><tr><td colspan="3"><strong>RFC standard:</strong></td><td colspan="17">This is a RFC 10 BioBrick, nothing was added</td></tr><tr><td colspan="20"> The BioBrick-AutoAnnotator was created by <a href="https://2013.igem.org/Team:TU-Munich">TU-Munich 2013</a> iGEM team. For information please read the <a href="https://2013.igem.org/Team:TU-Munich/Results/Software">description</a>.</td></tr></table><br> |
</html> | </html> | ||
<br><br> | <br><br> |
Revision as of 20:32, 26 July 2013
The AutoAnnotator
Introduction to the Idea behind our AutoAnnotator
The parts registry contains a wide range of interesting BioBricks from which many have similarity: they are not perfectly described and annotated. This is a real pity because after the identification of the open reading fram a multitude of parameters of the protein can be computed automatically. We are developing a tool which is able to identify the open reading frame of a BioBrick, analyze it for different parameters and export the results in a format that can easily be importet into a part description a a single table.
Figure on the steps.
Import of BioBrick Sequences
Determination of the Open Reading Frame
Analysis of Parameters
Export of the Computed Parameters
Automatically determined parameters using the BioBrick-AutoAnnotator | |||||||||||||||||||
Nucleotide sequence: (underlined part of entry was translated, italic parts were added) GTACACAATGCGTCGT...TTCGAAAAATAA | |||||||||||||||||||
Amino acid sequence:MRRSANYQPSIWDHDFLQSLNSNYTDEAYKRRAEELRGKVKIAIKDVIEPLDQLDLIDNLQRLGLAHRFETEIRNILNNIYNNNKDYNWRKENLYATSLE | |||||||||||||||||||
BioBrick: | Used open reading frame from position 8 to 1705 (excluding stop-codon; if appropriate prefix/suffix were added). | ||||||||||||||||||
A (Ala) | 33 (5.83%) | R (Arg) | 25 (4.42%) | N (Asn) | 27 (4.77%) | D (Asp) | 34 (6.01%) | C (Cys) | 4 (0.71%) | ||||||||||
Q (Gln) | 24 (4.24%) | E (Glu) | 48 (8.48%) | G (Gly) | 29 (5.12%) | H (His) | 18 (3.18%) | I (Ile) | 39 (6.89%) | ||||||||||
L (Leu) | 64 (11.31%) | K (Lys) | 36 (6.36%) | M (Met) | 16 (2.83%) | F (Phe) | 28 (4.95%) | P (Pro) | 17 (3.00%) | ||||||||||
S (Ser) | 33 (5.83%) | T (Thr) | 26 (4.59%) | W (Trp) | 14 (2.47%) | Y (Tyr) | 27 (4.77%) | V (Val) | 24 (4.24%) | ||||||||||
Amino acid counting: | Total number of amino acids (aa): | 566 | Number of positively charged aa (Arg + Lys): | 61 | Number of negatively charged aa (Asp + Glu): | 82 | |||||||||||||
Biochemical parameters: | Molecular weight [Da]: | 66105.33 | Theoretical pI: | 5.38 | Extinction coefficient: [M^-1 cm^-1] | 117480 (all Cys as cystine), 117230 (no Cys as cystine) | |||||||||||||
Estimated half-life: | Mammals: | 30 hour | Yeast: | >20 hour | E. coli: | >10 hour | |||||||||||||
Codon usage: (CAI) | Mammals: | 0.68 | Yeast: | 0.69 | E. coli: | 0.71 | |||||||||||||
RFC standard: | This is a RFC 10 BioBrick, nothing was added | ||||||||||||||||||
The BioBrick-AutoAnnotator was created by TU-Munich 2013 iGEM team. For information please read the description. |
References:
http://www.ncbi.nlm.nih.gov/pubmed/6327079 Edens et al., 1984
- http://www.ncbi.nlm.nih.gov/pubmed/6327079 Edens et al., 1984 Edens, L., Bom, I., Ledeboer, A. M., Maat, J., Toonen, M. Y., Visser, C., and Verrips, C. T. (1984). Synthesis and processing of the plant protein thaumatin in yeast. Cell, 37(2):629–33.
$(document).ready(function(){
// put the footer in the right place
$("#footer-box").prepend($("#social-footer"));
// implement image preloading
var images = new Array()
function preload() {
for (i = 0; i < preload.arguments.length; i++) { images[i] = new Image() images[i].src = preload.arguments[i] }
}
// preload menu backgrounds
preload( "",
"", "", "", "", "" );
// preload team pictures
if ( $("div#teamfield").length > 0 ) { preload( "",
"", "", "", "", "", "", "", "", "", // Katrin "", "", "", "", "", "", "", "", "", // Rosario "", "", "", "", "", "", "", "", "", // Fabian "", "", "", "", "", "", "", "", "", // Andreas "", "", "", "", "", "", "", "", "", // Louise "", "", "", "", "", "", "", "", "", // Johanna "", "", "", "", "", "", "", "", "", // Meike "", "", "", "", "", "", "", "", "", // Volker "", "", "", "", "", "", "", "", "", // Polte "", "", "", "", "", "", "", "", "", // Leonie "", "", "", "", "", "", "", "", "", // Philipp "", "", "", "", "", "", "", "", "", // Jeff "", "", "", "", "", "", "", "", "", // Chris "", "", "", "", "", "", "", "", "", // Flo "", "", "", "", "", "", "", "" );
}
// Slideshows
$('.bxslider').bxSlider({
responsive: false, auto: true, autoHover: true
});
$('.bxgallery').bxSlider({
slideMargin: 10, minSlides: 3, maxSlides: 3, moveSlides: 1, slideWidth: 5000
});
$("ul.bxgallery img").slimbox({ loop: true }, function(el) { url = el.src; url = url.substring(0, url.lastIndexOf('/')); url = url.replace('/thumb/', '/'); // description = $(el).parents("div.thumbinner").children("div.thumbcaption").text(); return [url, ]; }, function(el) { return (this == el) || (this.parentNode.parentNode && (this.parentNode.parentNode == el.parentNode.parentNode)); });
// Counter and Countdown
function render_counter(c) { i = 0; iid = window.setInterval(function(){ if ( (c-i) > (c/200) ) { $('span#counter').html(i); i += Math.round(c/200); } else { $('span#counter').html(c); window.clearInterval(iid); } }, 10); }
if ($('span#counter').length > 0) { $.ajax({ url: "https://2013.igem.org/Special:PopularPages", success: function( html ) { dom = $.parseHTML(html); visitors = $(dom).find('a[title="Team:TU-Munich"]').parent().text(); visitors = visitors.substring(visitors.indexOf('(')+1); visitors = visitors.substring(0, visitors.indexOf(' ')); visitors = visitors.replace(',', ); render_counter(visitors); }, error: function( xhr, status ) { render_counter(4700); } }); }
if ($('span#countdown) { clock = window.setInterval(function(){ jetzt = new Date(); time_left = Date.UTC(2013, 9, 5, 4, 0, 0) - Date.UTC(jetzt.getUTCFullYear(), jetzt.getUTCMonth(), jetzt.getUTCDate(), jetzt.getUTCHours(), jetzt.getUTCMinutes(), jetzt.getUTCSeconds()); left_sec = (time_left/1000)%60; left_sec = (left_sec < 10) ? "0" + left_sec : left_sec; left_min = Math.floor(time_left/60000)%60; left_min = (left_min < 10) ? "0" + left_min : left_min; left_h = Math.floor(time_left/3600000)%24; left_h = (left_h < 10) ? "0" + left_h : left_h; left_d = Math.floor(time_left/86400000); left_d = (left_d == 1) ? left_d + " day" : left_d + " days"; $('span#countdown').html(left_d + " " + left_h + ":" + left_min + ":" + left_sec); }, 1000); }
// Animate teamfield
if ( $("div#teamfield").length > 0 ) {
var $members = $("div#teamfield a");
$("body").mousemove(function(event){ for (i=0; i<$members.length; i++) {
if ( $members.eq(i).offset().left > event.pageX ) {
if ( $members.eq(i).offset().top > event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("top-left");
} else if ( $members.eq(i).offset().top <= event.pageY && ( $members.eq(i).offset().top + $members.eq(i).height() ) >= event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("left");
} else if ( ( $members.eq(i).offset().top + $members.eq(i).height() ) < event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("bottom-left");
}
} else if ( $members.eq(i).offset().left <= event.pageX && ( $members.eq(i).offset().left + $members.eq(i).width() ) >= event.pageX ) {
if ( $members.eq(i).offset().top > event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("top");
} else if ( $members.eq(i).offset().top <= event.pageY && ( $members.eq(i).offset().top + $members.eq(i).height() ) >= event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("front");
} else if ( ( $members.eq(i).offset().top + $members.eq(i).height() ) < event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("bottom");
}
} else if ( ( $members.eq(i).offset().left + $members.eq(i).width() ) < event.pageX ) {
if ( $members.eq(i).offset().top > event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("top-right");
} else if ( $members.eq(i).offset().top <= event.pageY && ( $members.eq(i).offset().top + $members.eq(i).height() ) >= event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("right");
} else if ( ( $members.eq(i).offset().top + $members.eq(i).height() ) < event.pageY ) {
$members.eq(i).removeClass(); $members.eq(i).addClass("bottom-right");
}
}
} });
}
});
AutoAnnotator:
Follow us:
Address:
iGEM Team TU-Munich
Emil-Erlenmeyer-Forum 5
85354 Freising, Germany
Email: igem@wzw.tum.de
Phone: +49 8161 71-4351